1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF164 Protein, Canine (HEK293)

VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGF164 Protein, Canine (HEK293) is the recombinant canine-derived VEGF164 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

VEGF164 Protein, Canine (HEK293) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGF164 Protein, Canine (HEK293) is the recombinant canine-derived VEGF164 protein, expressed by HEK293 , with tag free.

Background

VEGFA Protein has activity in angiogenesis and endothelial cell growth.
VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability.
VEGFA Protein can bind to receptors such as FLT1/VEGFR1 and KDR/VEGFR2, receptors such as DEAR/FBXW7-AS1, and sulfated acetylheparins and heparins.
The binding of VEGFA protein to NRP1 receptor initiates the signaling pathways required for motor neuron axon guidance and cell body migration, including the migration of facial motor neurons from rhomboid 4 to the tail of rhomboid 6 during embryonic development.
VEGF-A Protein is involved in the progression and malignant transformation of canine mastocytoma (MCT)

Biological Activity

1.Immobilized canine VEGF164/VEGFA at 10 μg/mL (100 μL/well) can bind human VEGFR2-Fc and the EC50 is 33.83-78.95 ng/mL.
2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 2-12 ng/mL.

Species

Canine

Source

HEK293

Tag

Tag Free

Accession

Q9MYV3-3/NP_001103972.1 (A27-R190)

Gene ID
Molecular Construction
N-term
VEGF164 (A27-R190)
Accession # Q9MYV3-3/NP_001103972.1
C-term
Protein Length

Full Length

Synonyms
VEGFA; Vascular endothelial growth factor A; VPF; VEGF
AA Sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Predicted Molecular Mass
19.1 kDa
Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF164 Protein, Canine (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF164 Protein, Canine (HEK293)
Cat. No.:
HY-P73473
Quantity:
MCE Japan Authorized Agent: