1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-D
  6. VEGF-DD Protein, Rat (HEK293, Fc)

VEGF-DD, a growth factor, stimulates proliferation, migration, and vessel permeability. It is crucial for vascular development and maintenance of lymphatic endothelium. VEGF-DD binds and activates VEGFR-3, initiating essential signaling pathways. Structurally, it forms a non-covalent homodimer, playing an intricate role in vascular processes. VEGF-DD Protein, Rat (HEK293, Fc) is the recombinant rat-derived VEGF-DD protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF-DD, a growth factor, stimulates proliferation, migration, and vessel permeability. It is crucial for vascular development and maintenance of lymphatic endothelium. VEGF-DD binds and activates VEGFR-3, initiating essential signaling pathways. Structurally, it forms a non-covalent homodimer, playing an intricate role in vascular processes. VEGF-DD Protein, Rat (HEK293, Fc) is the recombinant rat-derived VEGF-DD protein, expressed by HEK293 , with N-hFc labeled tag.

Background

VEGF-DD, a growth factor with pivotal roles in angiogenesis, lymphangiogenesis, and endothelial cell dynamics, demonstrates the ability to stimulate cellular proliferation and migration, along with influencing blood vessel permeability. Its significance extends to the formation of both venous and lymphatic vascular systems during embryogenesis, as well as the maintenance of differentiated lymphatic endothelium in adults. Functionally, VEGF-DD binds to and activates the VEGFR-3 (Flt4) receptor, initiating crucial signaling pathways for vascular development and homeostasis. Structurally, VEGF-DD exists as a homodimer with a non-covalent and antiparallel configuration, emphasizing its intricate role in orchestrating complex vascular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized recombinant Rat VEGF-DD at 10 μg/mL (100 μL/well) can bind biotinylated Mouse VEGFR-3. The ED50 for this effect is 312.9 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized recombinant Rat VEGF-DD at 10 μg/mL (100 μL/well) can bind biotinylated Mouse VEGFR-3 .The ED50 for this effect is 312.9 ng/mL.
Species

Rat

Source

HEK293

Tag

N-hFc

Accession

O35251 (F94-R210)

Gene ID
Molecular Construction
N-term
hFc
VEGF-DD (F94-R210)
Accession # O35251
C-term
Synonyms
Vascular endothelial growth factor D; VEGF-D; FIGF
AA Sequence

FAATFYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRR

Molecular Weight

Approximately 50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF-DD Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF-DD Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73475
Quantity:
MCE Japan Authorized Agent: