1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-C
  6. VEGF-CC Protein, Human (196a.a, HEK293, His)

The VEGF-CC protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-CC Protein, Human (196a.a, HEK293, His) is the recombinant human-derived VEGF-CC protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VEGF-CC protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-CC Protein, Human (196a.a, HEK293, His) is the recombinant human-derived VEGF-CC protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The VEGF-CC Protein is a growth factor with significant activity in angiogenesis and endothelial cell growth, effectively stimulating their proliferation and migration while also influencing the permeability of blood vessels. This multifaceted protein is implicated in angiogenesis within both the venous and lymphatic vascular systems during embryogenesis and contributes to the maintenance of differentiated lymphatic endothelium in adults. VEGF-CC achieves these functions by binding and activating receptors KDR/VEGFR2 and FLT4/VEGFR3. Structurally, VEGF-CC exists as a homodimer, displaying a non-covalent and antiparallel arrangement. The protein's interaction with FLT4/VEGFR3 is crucial, as it is required for FLT4/VEGFR3 homodimerization and subsequent activation. These features collectively underscore the diverse roles of VEGF-CC in regulating vascular processes and highlight its significance in both developmental and adult angiogenesis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P49767 (F32-R227)

Gene ID
Molecular Construction
N-term
VEGF-CC (F32-R227)
Accession # P49767
6*His
C-term
Synonyms
Vascular Endothelial Growth Factor C; VEGF-C; Flt4 Ligand; Flt4-L; Vascular Endothelial Growth Factor-Related Protein; VRP; VEGFC
AA Sequence

FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Weight

25-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

VEGF-CC Protein, Human (196a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF-CC Protein, Human (196a.a, HEK293, His)
Cat. No.:
HY-P70501
Quantity:
MCE Japan Authorized Agent: