1. Recombinant Proteins
  2. Others
  3. Vinculin Protein, Human (GST)

Vinculin Protein, an actin-binding protein, is crucial for cell adhesion, morphology, and mechanosensing. It regulates E-cadherin expression and enhances mechanosensing. Vinculin forms complexes with THSD1, PTK2/FAK1, TLN1, and VCL, and interacts with APBB1IP, NRAP, CTNNB1, SYNM, SORBS1, and CTNNA1. Its interaction with CTNNA1 is necessary for localization to cell-cell junctions. Vinculin also binds to ACTN4, causing conformational changes. Vinculin Protein, Human (GST) is the recombinant human-derived Vinculin protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Vinculin Protein, an actin-binding protein, is crucial for cell adhesion, morphology, and mechanosensing. It regulates E-cadherin expression and enhances mechanosensing. Vinculin forms complexes with THSD1, PTK2/FAK1, TLN1, and VCL, and interacts with APBB1IP, NRAP, CTNNB1, SYNM, SORBS1, and CTNNA1. Its interaction with CTNNA1 is necessary for localization to cell-cell junctions. Vinculin also binds to ACTN4, causing conformational changes. Vinculin Protein, Human (GST) is the recombinant human-derived Vinculin protein, expressed by E. coli , with N-GST labeled tag.

Background

Vinculin Protein, an actin filament (F-actin)-binding protein, is extensively involved in cell-matrix adhesion and cell-cell adhesion, playing crucial roles in cell morphology, locomotion, and mechanosensing. It regulates the expression of cell-surface E-cadherin and enhances mechanosensing through the E-cadherin complex. Vinculin exhibits self-association properties and forms a complex with THSD1, PTK2/FAK1, TLN1, and VCL. It interacts with APBB1IP, NRAP, TLN1, CTNNB1, SYNM, SORBS1, and CTNNA1, and its interaction with CTNNA1 is necessary for its localization to cell-cell junctions and regulation of E-cadherin expression. Additionally, Vinculin binds to ACTN4, triggering conformational changes.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P18206 (2P-235E)

Gene ID
Molecular Construction
N-term
GST
Vinculin (2P-235E)
Accession # P18206
C-term
Protein Length

Partial

Synonyms
CMD1W; CMH15; Epididymis luminal protein 114; HEL114; Metavinculin; MV; MVCL; Vinculin
AA Sequence

PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVE

Predicted Molecular Mass
53.0 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Vinculin Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vinculin Protein, Human (GST)
Cat. No.:
HY-P71693
Quantity:
MCE Japan Authorized Agent: