1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. USP8 Protein, Human (sf9, His, GST)

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
50 μg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

Background

USP8, a hydrolase with pivotal roles in cellular regulation, serves as a crucial player in protein turnover by effectively removing conjugated ubiquitin from proteins, preventing their degradation. This enzymatic action extends to both 'Lys-48' and 'Lys-63'-linked ubiquitin chains, showcasing its versatility in modulating ubiquitin dynamics. USP8's catalytic activity is notably enhanced during the M phase, underlining its cell cycle-dependent regulatory functions. The enzyme is intricately involved in various cellular processes, including cell proliferation and the response to serum stimulation, where it is required for S phase entry. Additionally, USP8 is implicated in the modulation of T-cell anergy, stabilization of proteins such as STAM2 and RASGRF1, and regulation of endosomal dynamics, cargo sorting, and membrane traffic. Its role in controlling ubiquitination on endosomes is essential for maintaining the organelle's morphology. USP8 further exerts influence on diverse pathways, including acrosome biogenesis, EGFR degradation, MAPK signaling, and the modulation of BACE1-mediated APP cleavage and amyloid-beta formation. The multifaceted functions of USP8 highlight its significance in maintaining cellular homeostasis and orchestrating various signaling cascades.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P40818-1 (P734-G1110)

Gene ID

9101

Protein Length

Partial

Synonyms
Ubiquitin carboxyl-terminal hydrolase 8; Deubiquitinating enzyme 8; Ubiquitin isopeptidase Y (hUBPy); Ubiquitin thioesterase 8; Ubiquitin-specific-processing protease 8; KIAA0055; UBPY
AA Sequence

PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

Predicted Molecular Mass
70.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50mM Tris-HCl (pH 7.5), 200mM NaCl, 5% glycerol, 1mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

USP8 Protein, Human (sf9, His, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
USP8 Protein, Human (sf9, His, GST)
Cat. No.:
HY-P703652
Quantity:
MCE Japan Authorized Agent: