USP14 Protein, Human (399a.a, His)

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (399a.a, His) is the recombinant human-derived USP14 protein, expressed by E. coli, with N-His labeled tag.

USP14, a proteasome-associated deubiquitinase, emerges as a crucial player in cellular processes, particularly in the dynamic regulation of ubiquitin at the proteasome. Functioning as a reversibly associated subunit of the proteasome, USP14 ensures the release of ubiquitin from ubiquitinated proteins targeted for degradation, facilitating the regeneration of ubiquitin within the cellular environment. Beyond its role in proteasome-mediated protein turnover, USP14 plays a pivotal role in diverse physiological contexts. It is involved in the degradation of the chemokine receptor CXCR4, a critical event for CXCL12-induced cell chemotaxis. Additionally, USP14 serves as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under non-stressed conditions, interacting with ERN1 and modulating the degradation of unfolded endoplasmic reticulum proteins. Furthermore, USP14 contributes to synaptic development and function at neuromuscular junctions (NMJs) and participates in the innate immune defense against viruses by stabilizing the viral DNA sensor CGAS, thereby impeding its autophagic degradation.

Human

E. coli

N-His

P54578-1 (Q96-Q494)

9097

Partial

LASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Approximately 47.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.