1. Recombinant Proteins
  2. Others
  3. UPP1 Protein, Human (His)

UPP1 protein is a key member of the PNP/UDP phosphorylase family and plays an important role in cellular processes, especially nucleotide metabolism. UPP1 shares conserved features with related proteins and is involved in phosphorylase activity. UPP1 Protein, Human (His) is the recombinant human-derived UPP1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UPP1 protein is a key member of the PNP/UDP phosphorylase family and plays an important role in cellular processes, especially nucleotide metabolism. UPP1 shares conserved features with related proteins and is involved in phosphorylase activity. UPP1 Protein, Human (His) is the recombinant human-derived UPP1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The UPP1 Protein is a vital member of the PNP/UDP phosphorylase family, highlighting its essential role in cellular processes. As part of this enzyme family, UPP1 likely shares conserved structural and functional features with related proteins, signifying its involvement in phosphorylase activities. The classification within the PNP/UDP phosphorylase family underscores its specific designation within the broader context of phosphorylases, providing insights into its unique enzymatic functions. The study of UPP1 contributes to our understanding of its role in cellular processes related to nucleotide metabolism, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in phosphorylation. Further exploration of UPP1's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q86Y75 (M1-A173)

Gene ID
Molecular Construction
N-term
6*His
UPP1 (M1-A173)
Accession # Q86Y75
C-term
Synonyms
UPP1 Protein; Uridine Phosphorylase 1; UPP1
AA Sequence

MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

Molecular Weight

Approximately 21 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UPP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UPP1 Protein, Human (His)
Cat. No.:
HY-P71416
Quantity:
MCE Japan Authorized Agent: