1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins
  4. U-PAR/CD87
  5. uPAR Protein, Mouse (HEK293, His-Fc)

uPAR (urokinase plasminogen activator receptor) possesses enzyme, protein, and receptor binding activities.It regulates apoptotic signaling, epidermal growth factor signaling, and cytochrome c release.uPAR is widely expressed in structures like decidua and spleen.Its human ortholog, PLAUR, is linked to rheumatoid arthritis.Investigating uPAR can reveal its role in cellular processes and shed light on diseases like rheumatoid arthritis.uPAR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

uPAR (urokinase plasminogen activator receptor) possesses enzyme, protein, and receptor binding activities.It regulates apoptotic signaling, epidermal growth factor signaling, and cytochrome c release.uPAR is widely expressed in structures like decidua and spleen.Its human ortholog, PLAUR, is linked to rheumatoid arthritis.Investigating uPAR can reveal its role in cellular processes and shed light on diseases like rheumatoid arthritis.uPAR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

uPAR (urokinase plasminogen activator receptor), a multifaceted protein, is predicted to possess enzyme binding activity, protein domain-specific binding activity, and signaling receptor binding activity. It is anticipated to play a role in various processes, including the negative regulation of the apoptotic signaling pathway, positive regulation of the epidermal growth factor receptor signaling pathway, and positive regulation of the release of cytochrome c from mitochondria. As an integral component of the plasma membrane, uPAR exhibits broad expression in diverse structures such as decidua, early conceptus, and spleen. The human ortholog of this gene, PLAUR (plasminogen activator, urokinase receptor), has implications in conditions like rheumatoid arthritis, highlighting the potential significance of uPAR in physiological and pathological contexts. Studies on uPAR may unveil its intricate involvement in cellular processes and contribute to our understanding of diseases like rheumatoid arthritis.

Biological Activity

Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED50 for this effect is <50.73 ng/mL.

  • Immobilized Recombinant rmuPAR/Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant rhuPA Protein. The ED50 for this effect is 50.73 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

P35456-1/NP_035243.1 (L24-T297)

Gene ID
Molecular Construction
N-term
uPAR (L24-T297)
Accession # P35456-1/NP_035243.1
hFc-His
C-term
Protein Length

Partial

Synonyms
Urokinase plasminogen activator surface receptor; U-PAR; CD87; PLAUR; MO3
AA Sequence

LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

Molecular Weight

80-90 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

uPAR Protein, Mouse (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
uPAR Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P77275
Quantity:
MCE Japan Authorized Agent: