1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins
  4. U-PAR/CD87
  5. uPAR Protein, Human (HEK293, His)

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (HEK293, His) is the recombinant human-derived uPAR protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (HEK293, His) is the recombinant human-derived uPAR protein, expressed by HEK293 , with C-6*His labeled tag.

Background

uPAR Protein functions as a receptor for urokinase plasminogen activator, actively participating in the localization and facilitation of plasmin formation. Additionally, it serves as a mediator of the proteolysis-independent signal transduction activation effects induced by U-PA. Subject to negative-feedback regulation by U-PA, uPAR Protein undergoes cleavage into an inactive form. Typically existing as a monomer, it interacts with various proteins, including MRC2, SRPX2 (via the UPAR/Ly6 domains), and FAP (seprase), with the latter interaction occurring at the cell surface of invadopodia membrane. Moreover, uPAR Protein engages in an interaction with SORL1, specifically through the N-terminal ectodomain, and this interaction has been associated with a decrease in PLAUR internalization. Notably, the formation of a ternary complex composed of PLAUR, PLAU (urokinase-type plasminogen activator), and SERPINE1 also involves an interaction with SORL1.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human uPAR at 1 μg/mL (100 μL/well) can bind biotinylated human UPA. The ED50 for this effect is 1.5 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q03405-1 (L23-R303)

Gene ID
Molecular Construction
N-term
uPAR (L23-R303)
Accession # Q03405-1
6*His
C-term
Protein Length

Partial

Synonyms
Urokinase plasminogen activator surface receptor; U-PAR; CD87; PLAUR; MO3
AA Sequence

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR

Molecular Weight

Approximately 52 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 8% Trehaolse, 2% Dextran-70, 50 mM NaCl, 0.05% Tween80, pH 8.5 or PBS, pH7.4 or PBS, pH7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

uPAR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
uPAR Protein, Human (HEK293, His)
Cat. No.:
HY-P72433
Quantity:
MCE Japan Authorized Agent: