1. Recombinant Proteins
  2. CD Antigens
  3. Endothelial cell CD Proteins
  4. uPAR Protein, Human (GST)

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (GST) is the recombinant human-derived uPAR protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (GST) is the recombinant human-derived uPAR protein, expressed by E. coli , with N-GST labeled tag.

Background

uPAR Protein functions as a receptor for urokinase plasminogen activator, actively participating in the localization and facilitation of plasmin formation. Additionally, it serves as a mediator of the proteolysis-independent signal transduction activation effects induced by U-PA. Subject to negative-feedback regulation by U-PA, uPAR Protein undergoes cleavage into an inactive form. Typically existing as a monomer, it interacts with various proteins, including MRC2, SRPX2 (via the UPAR/Ly6 domains), and FAP (seprase), with the latter interaction occurring at the cell surface of invadopodia membrane. Moreover, uPAR Protein engages in an interaction with SORL1, specifically through the N-terminal ectodomain, and this interaction has been associated with a decrease in PLAUR internalization. Notably, the formation of a ternary complex composed of PLAUR, PLAU (urokinase-type plasminogen activator), and SERPINE1 also involves an interaction with SORL1.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q03405 (L23-G305)

Gene ID

5329

Molecular Construction
N-term
GST
uPAR (L23-G305)
Accession # Q03405
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Urokinase plasminogen activator surface receptor; U-PAR; CD87; PLAUR; MO3
AA Sequence

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG

Predicted Molecular Mass
58.5 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

uPAR Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
uPAR Protein, Human (GST)
Cat. No.:
HY-P702769
Quantity:
MCE Japan Authorized Agent: