1. Recombinant Proteins
  2. Receptor Proteins
  3. UNC5B Protein, Human (HEK293, His)

UNC5B is an important netrin receptor that mediates axonal repulsion during nervous system development and binds to DCC to trigger signaling pathways. It negatively regulates vascular branching in angiogenesis, inducing tip cell filopodia retraction. UNC5B Protein, Human (HEK293, His) is the recombinant human-derived UNC5B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UNC5B is an important netrin receptor that mediates axonal repulsion during nervous system development and binds to DCC to trigger signaling pathways. It negatively regulates vascular branching in angiogenesis, inducing tip cell filopodia retraction. UNC5B Protein, Human (HEK293, His) is the recombinant human-derived UNC5B protein, expressed by HEK293 , with C-His labeled tag.

Background

UNC5B, a crucial receptor for netrin, emerges as a key player in axon guidance, primarily mediating axon repulsion in neuronal growth cones during the development of the nervous system upon ligand binding. This repulsive effect is suggested to be orchestrated by its association with DCC, potentially triggering signaling pathways leading to axon repulsion. Beyond its role in neural development, UNC5B operates as a netrin receptor with negative regulatory impact on vascular branching during angiogenesis, facilitating the retraction of tip cell filopodia on endothelial growth cones in response to netrin. Notably, UNC5B also functions as a dependence receptor, inducing apoptosis when not engaged with the netrin ligand, a process that involves the activation of DAPK1. In the absence of netrin, UNC5B activates DAPK1 by reducing its autoinhibitory phosphorylation, thereby enhancing its catalytic activity. The receptor engages in diverse protein interactions, including the cytoplasmic part of DCC, GNAI2, FLRT3, FLRT2, and FLRT3 in a context-dependent manner, underlining its multifaceted role in axon guidance, angiogenesis regulation, and apoptotic signaling.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized UNC5B at 5 µg/mL (100 µL/well) can bind rmNetrin-1. The ED50 for this effect is 306.6 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8IZJ1 (G27-P363)

Gene ID
Molecular Construction
N-term
UNC5B (G27-P363)
Accession # Q8IZJ1
His
C-term
Protein Length

Partial

Synonyms
Netrin receptor UNC5B; p53RDL1; UNC5B; P53RDL1; UNC5H2
AA Sequence

GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDP

Molecular Weight

Approximately 48-52 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

UNC5B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UNC5B Protein, Human (HEK293, His)
Cat. No.:
HY-P74481
Quantity:
MCE Japan Authorized Agent: