1. Recombinant Proteins
  2. Others
  3. ULBP-6/RAET1L Protein, Human (HEK293, His)

ULBP-6/RAET1L Protein, a key immune response modulator, activates the KLRK1/NKG2D receptor, triggering natural killer (NK) cell cytotoxicity. This engagement is pivotal for the immune system's defense against threats, showcasing ULBP-6/RAET1L's orchestration of NK cell responses. Its specificity is highlighted by the absence of a binding association with beta2-microglobulin in molecular interactions. ULBP-6/RAET1L Protein, Human (HEK293, His) is the recombinant human-derived ULBP-6/RAET1L protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ULBP-6/RAET1L Protein, a key immune response modulator, activates the KLRK1/NKG2D receptor, triggering natural killer (NK) cell cytotoxicity. This engagement is pivotal for the immune system's defense against threats, showcasing ULBP-6/RAET1L's orchestration of NK cell responses. Its specificity is highlighted by the absence of a binding association with beta2-microglobulin in molecular interactions. ULBP-6/RAET1L Protein, Human (HEK293, His) is the recombinant human-derived ULBP-6/RAET1L protein, expressed by HEK293 , with C-His labeled tag.

Background

NKG2DL2, a key participant in immune response modulation, exerts its influence by binding to and activating the KLRK1/NKG2D receptor. This interaction serves as a pivotal trigger for natural killer (NK) cell cytotoxicity, a fundamental aspect of the immune system's defense against various threats. NKG2DL2's ability to engage with KLRK1/NKG2D underscores its role in orchestrating NK cell responses. Notably, it does not form a binding association with beta2-microglobulin, further elucidating the specificity of its molecular interactions.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human NKG2D/CD314 is immobilized at 1 μg/mL (100 μL/well) can bind Human ULBP-6/RAET1L. The ED50 for this effect is 27.800 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q5VY80 (R26-S217)

Gene ID

154064  [NCBI]

Molecular Construction
N-term
ULBP6 (R26-S217)
Accession # Q5VY80
His
C-term
Synonyms
UL16-binding protein 6; Retinoic acid early transcript 1L protein; ULBP6; RAET1L
AA Sequence

RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ULBP-6/RAET1L Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP-6/RAET1L Protein, Human (HEK293, His)
Cat. No.:
HY-P77503
Quantity:
MCE Japan Authorized Agent: