1. Recombinant Proteins
  2. Others
  3. ULBP4/RAET1E Protein, Human (HEK293, His)

ULBP4/RAET1E Protein crucially activates natural killer cell cytotoxicity by binding to and activating the KLRK1/NKG2D receptor. This interaction mediates cytotoxic responses, contributing to receptor activation and facilitating the recognition and targeting of marked cells for elimination. ULBP4/RAET1E's engagement with KLRK1/NKG2D underscores its significance in immune response regulation and natural killer cell activity modulation. ULBP4/RAET1E Protein, Human (HEK293, His) is the recombinant human-derived ULBP4/RAET1E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ULBP4/RAET1E Protein crucially activates natural killer cell cytotoxicity by binding to and activating the KLRK1/NKG2D receptor. This interaction mediates cytotoxic responses, contributing to receptor activation and facilitating the recognition and targeting of marked cells for elimination. ULBP4/RAET1E's engagement with KLRK1/NKG2D underscores its significance in immune response regulation and natural killer cell activity modulation. ULBP4/RAET1E Protein, Human (HEK293, His) is the recombinant human-derived ULBP4/RAET1E protein, expressed by HEK293 , with C-His labeled tag.

Background

The ULBP4/RAET1E protein plays a crucial role in natural killer cell cytotoxicity by serving as a ligand that binds to and activates the KLRK1/NKG2D receptor. This interaction between ULBP4/RAET1E and KLRK1/NKG2D is pivotal in mediating the cytotoxic responses of natural killer cells. Through its binding affinity with KLRK1/NKG2D, ULBP4/RAET1E contributes to the activation of this receptor, facilitating the recognition and targeting of cells marked for elimination. The engagement of ULBP4/RAET1E with KLRK1/NKG2D underscores its significance in the regulation of immune responses and the modulation of natural killer cell activity.

Biological Activity

Measured by the ability of the immobilized protein to induce IFN-gamma secretion in NK‑92 human natural killer lymphoma cells. The ED50 for this effect is 2.508 μg/mL, corresponding to a specific activity is 398.724 U/mg.

  • Measured by the ability of the immobilized protein to induce IFN-gamma secretion in NK‑92 human natural killer lymphoma cells. The ED50 for this effect is 2.508 μg/mL, corresponding to a specific activity is 398.724 U/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q8TD07-1 (H31-D225)

Gene ID
Molecular Construction
N-term
ULBP4 (H31-D225)
Accession # Q8TD07-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Retinoic acid early transcript 1E; NKG2D ligand 4; LETAL; N2DL4
AA Sequence

HSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD

Molecular Weight

Approximately 35-40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ULBP4/RAET1E Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP4/RAET1E Protein, Human (HEK293, His)
Cat. No.:
HY-P76691
Quantity:
MCE Japan Authorized Agent: