1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. UDP-glucose 4-epimerase/GALE Protein, Human (His)

UDP-glucose 4-epimerase/GALE Protein, Human (His)

Cat. No.: HY-P70418
Handling Instructions Technical Support

GALE proteins catalyze the reversible epimerization of UDP-glucose to UDP-galactose, and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. UDP-glucose 4-epimerase/GALE Protein, Human (His) is the recombinant human-derived UDP-glucose 4-epimerase/GALE protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GALE proteins catalyze the reversible epimerization of UDP-glucose to UDP-galactose, and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. UDP-glucose 4-epimerase/GALE Protein, Human (His) is the recombinant human-derived UDP-glucose 4-epimerase/GALE protein, expressed by E. coli , with N-6*His labeled tag.

Background

UDP-glucose 4-epimerase (GALE) protein orchestrates two distinct yet analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The conversion of UDP-glucose to UDP-galactose is crucial in the Leloir pathway of galactose catabolism, directing galactose into the glycolytic intermediate glucose 6-phosphate. GALE's role is pivotal in the breakdown of dietary galactose and facilitates the endogenous biosynthesis of UDP-Gal and UDP-GalNAc when external sources are limited. These UDP-sugar interconversions are integral to the intricate processes involved in the synthesis of glycoproteins and glycolipids, underscoring the significance of GALE in cellular glycan biosynthesis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q14376-1 (M1-A348)

Gene ID
Molecular Construction
N-term
6*His
GALE (M1-A348)
Accession # Q14376-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
rHuUDP-glucose 4-epimerase/GALE, His; UDP-Glucose 4-Epimerase; Galactowaldenase; UDP-Galactose 4-Epimerase; GALE
AA Sequence

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

Molecular Weight

Approximately 38.23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 2 mM DTT, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UDP-glucose 4-epimerase/GALE Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UDP-glucose 4-epimerase/GALE Protein, Human (His)
Cat. No.:
HY-P70418
Quantity:
MCE Japan Authorized Agent: