1. Recombinant Proteins
  2. Others
  3. UCMA Protein, Human

UCMA proteins are key regulators of the complex control of osteogenic differentiation, particularly in the fetal cartilage periphery and at the cartilage-bone interface. Its involvement suggests a crucial role in negatively regulating osteochondral precursor cell differentiation. UCMA Protein, Human is the recombinant human-derived UCMA protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UCMA proteins are key regulators of the complex control of osteogenic differentiation, particularly in the fetal cartilage periphery and at the cartilage-bone interface. Its involvement suggests a crucial role in negatively regulating osteochondral precursor cell differentiation. UCMA Protein, Human is the recombinant human-derived UCMA protein, expressed by E. coli , with tag free.

Background

UCMA Protein emerges as a potential key player in the intricate regulation of osteogenic differentiation, particularly within the peripheral zones of fetal cartilage and at the cartilage-bone interface. Its involvement suggests a crucial role in exerting negative control over the differentiation processes of osteochondrogenic precursor cells. UCMA's regulatory impact within these specific anatomical regions underscores its significance in modulating the delicate balance of cellular differentiation, with potential implications for skeletal development and homeostasis. Unraveling the precise mechanisms by which UCMA exerts its negative control on osteogenic differentiation could provide valuable insights into its functional significance and contribute to a deeper understanding of the molecular pathways governing skeletal tissue development and maintenance.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8WVF2 (S65-T138)

Gene ID
Molecular Construction
N-term
UCMA (S65-T138)
Accession # Q8WVF2
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Unique cartilage matrix-associated protein; UCMA; Gla-rich protein; C10orf49
AA Sequence

SPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

Predicted Molecular Mass
9.8 kDa
Molecular Weight

Approximately 14 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UCMA Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UCMA Protein, Human
Cat. No.:
HY-P71413
Quantity:
MCE Japan Authorized Agent: