1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Deubiquitinase
  4. UCH Proteins
  5. UCH-L3
  6. UCHL3 Protein, Rat (His)

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Background

UCHL3 Protein, a deubiquitinating enzyme (DUB), intricately governs cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. Functioning as a thiol protease, UCHL3 selectively recognizes and hydrolyzes peptide bonds at the C-terminal glycine of ubiquitin or NEDD8, displaying a notable 10-fold preference for Arg and Lys at position P3 and a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, thereby finely regulating apical membrane recycling. Its influence extends to insulin signaling and adipogenesis, indirectly enhancing the phosphorylation of IGFIR, AKT, and FOXO1. Essential for stress-response in retinal, skeletal muscle, and germ cell maintenance, UCHL3 may also play a role in working memory. Notably, it exhibits the capability to hydrolyze UBB(+1), a mutated form of ubiquitin resistant to proteasomal degradation, emphasizing its significance in the dynamic control of cellular processes and homeostasis.

Biological Activity

The specific activity of UCHL3 was 68.654 nmoL/min/mg in DUB assay using ubiquitin-based proluciferin as substrate.

Species

Rat

Source

E. coli

Tag

N-His

Accession

Q91Y78 (E2-A230)

Gene ID
Molecular Construction
N-term
His
UCHL3 (E2-A230)
Accession # Q91Y78
C-term
Protein Length

Partial

Synonyms
Ubiquitin carboxyl-terminal hydrolase isozyme L3; UCH-L3; Ubiquitin thioesterase L3
AA Sequence

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Weight

Approximately 28 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

UCHL3 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UCHL3 Protein, Rat (His)
Cat. No.:
HY-P76689
Quantity:
MCE Japan Authorized Agent: