2. Recombinant Proteins
  3. Ubiquitin Related Proteins
  4. Ubiquitin Enzymes
  5. E2 Enzymes
  6. Ubiquitin-Conjugating Enzyme E2 Z
  7. UBE2Z Protein, Human (His)

UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2Z Protein, a catalyst in ubiquitin conjugation, facilitates the covalent attachment of ubiquitin to target proteins. It serves as a specific substrate for UBA6 and is implicated in the regulation of apoptosis. UBE2Z Protein, Human (His) is the recombinant human-derived UBE2Z protein, expressed by E. coli , with N-6*His labeled tag.
Background

UBE2Z protein serves as an enzyme that catalyzes the covalent attachment of ubiquitin to other proteins, operating as a substrate specifically for UBA6 and not charged with ubiquitin by UBE1. This implies its involvement in the intricate process of apoptosis regulation, underscoring its role in the ubiquitin-mediated modification of target proteins.
Species

Human
Source

E. coli
Tag

N-6*His
Accession

Q9H832-2 (M1-V246)
Gene ID
Molecular Construction
N-term
6*His
UBE2Z (M1-V246)
Accession # Q9H832-2
C-term
Protein Length

Full Length of Isoform-2
Synonyms
Ubiquitin-Conjugating Enzyme E2 Z; Uba6-Specific E2 Conjugating Enzyme 1; Use1; Ubiquitin Carrier Protein Z; Ubiquitin-Protein Ligase Z; UBE2Z; HOYS7
AA Sequence

MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

Predicted Molecular Mass
30.2 kDa
Molecular Weight

Approximately 32 kDa,based on SDS-PAGE under reducing conditions.
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

UBE2Z Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2Z Protein, Human (His)
Cat. No.:
HY-P71412
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.