1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin-conjugating enzyme E2 W
  6. UBE2W Protein, Human (His)

UBE2W protein is a multifunctional ubiquitin-conjugating enzyme that accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to different substrates. Notably, UBE2W uniquely monoubiquitylates the N-terminus, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showing specificity for disordered N-termini. UBE2W Protein, Human (His) is the recombinant human-derived UBE2W protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2W protein is a multifunctional ubiquitin-conjugating enzyme that accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to different substrates. Notably, UBE2W uniquely monoubiquitylates the N-terminus, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showing specificity for disordered N-termini. UBE2W Protein, Human (His) is the recombinant human-derived UBE2W protein, expressed by E. coli , with N-His labeled tag.

Background

UBE2W, a versatile ubiquitin-conjugating enzyme, fulfills a crucial role in cellular processes by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to diverse substrates (PubMed:20061386, PubMed:21229326). Notably, UBE2W exhibits a unique ability to monoubiquitinate the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showcasing its specificity for disordered N-termini (PubMed:23560854, PubMed:23696636, PubMed:25436519). This monoubiquitination process plays a critical role in the degradation of misfolded chaperone substrates, as UBE2W mediates the monoubiquitination of STUB1/CHIP, leading to the recruitment of ATXN3 and restriction of the ubiquitin chain length attached to STUB1/CHIP substrates (PubMed:23696636, PubMed:25436519). Moreover, UBE2W, particularly activated by UV irradiation, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex, collaborating with E3 ubiquitin-protein ligase FANCL to catalyze monoubiquitination of FANCD2, a crucial step in the DNA damage response pathway (PubMed:19111657, PubMed:21229326). In addition to its versatile monoubiquitination capabilities, UBE2W can catalyze 'Lys-11'-linked polyubiquitination in vitro, demonstrating its flexibility in ubiquitin chain formation (PubMed:25436519).

Biological Activity

Under ATP and E1 conditions, UBE2W binds with ubiquitin molecules to form thioester complexes UBE2W-Ub.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q96B02-1 (M1-C151)

Gene ID
Molecular Construction
N-term
His
UBE2W (M1-C151)
Accession # Q96B02-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Ubiquitin-conjugating enzyme E2 W; UBC-16; Ubiquitin-protein ligase W; UBC16
AA Sequence

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Molecular Weight

Approximately 18kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 100 mM Arg.0.1% Brij35, pH 8.5 or 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2W Protein, Human (His)
Cat. No.:
HY-P77272
Quantity:
MCE Japan Authorized Agent: