1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin-Conjugating Enzyme E2 H
  6. UBE2H Protein, Human (GST)

UBE2H Protein, a crucial participant in cellular ubiquitination, transfers ubiquitin from the E1 complex to various proteins, including MAEA of the CTLH E3 ubiquitin-protein ligase complex. Versatile in vitro, UBE2H catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination, showcasing its involvement in diverse ubiquitin-related processes. Notably, it demonstrates the capability to ubiquitinate histone H2A in vitro. UBE2H Protein, Human (GST) is the recombinant human-derived UBE2H protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2H Protein, a crucial participant in cellular ubiquitination, transfers ubiquitin from the E1 complex to various proteins, including MAEA of the CTLH E3 ubiquitin-protein ligase complex. Versatile in vitro, UBE2H catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination, showcasing its involvement in diverse ubiquitin-related processes. Notably, it demonstrates the capability to ubiquitinate histone H2A in vitro. UBE2H Protein, Human (GST) is the recombinant human-derived UBE2H protein, expressed by E. coli , with N-GST labeled tag.

Background

UBE2H, a crucial participant in cellular ubiquitination processes, plays a pivotal role in the transfer of ubiquitin from the E1 complex to various proteins. Particularly noteworthy is its ability to transfer ubiquitin to MAEA, a core component of the CTLH E3 ubiquitin-protein ligase complex. In vitro studies demonstrate UBE2H's versatility as it catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Additionally, UBE2H exhibits the capability to ubiquitinate histone H2A in vitro, highlighting its involvement in diverse ubiquitin-related processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P62256 (M1-L183)

Gene ID
Molecular Construction
N-term
GST
UBE2H (M1-L183)
Accession # P62256
C-term
Protein Length

Full Length

Synonyms
Ubiquitin-Conjugating Enzyme E2 H; UbcH2; Ubiquitin Carrier Protein H; Ubiquitin-Conjugating Enzyme E2-20K; Ubiquitin-Protein Ligase H; UBE2H
AA Sequence

MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

Molecular Weight

Approximately 50.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2H Protein, Human (GST)
Cat. No.:
HY-P71402
Quantity:
MCE Japan Authorized Agent: