1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin Conjugating Enzyme E2 G2
  6. UBE2G2 Protein, Human (GST)

The UBE2G2 protein is an important ubiquitination component that accepts ubiquitin in the E1 complex, catalyzes its covalent attachment to various proteins, and preferentially performs "Lys-48"-linked polyubiquitination. Its specificity in shaping ubiquitin chains emphasizes its role in cellular processes. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2G2 protein is an important ubiquitination component that accepts ubiquitin in the E1 complex, catalyzes its covalent attachment to various proteins, and preferentially performs "Lys-48"-linked polyubiquitination. Its specificity in shaping ubiquitin chains emphasizes its role in cellular processes. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli , with N-GST labeled tag.

Background

UBE2G2, a crucial component in the ubiquitination machinery, plays a pivotal role in the cellular process by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various proteins. In vitro, UBE2G2 demonstrates a specific catalytic preference for 'Lys-48'-linked polyubiquitination, highlighting its involvement in shaping ubiquitin chains with specific linkages. Notably, UBE2G2 is intricately associated with endoplasmic reticulum-associated degradation (ERAD), underlining its significance in maintaining cellular homeostasis by regulating protein turnover. Furthermore, UBE2G2 is indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, facilitating its subsequent proteasomal degradation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P60604 (M1-L165)

Gene ID
Molecular Construction
N-term
GST
UBE2G2 (M1-L165)
Accession # P60604
C-term
Protein Length

Full Length

Synonyms
Ubiquitin-Conjugating Enzyme E2 G2; Ubiquitin Carrier Protein G2; Ubiquitin-Protein Ligase G2; UBE2G2
AA Sequence

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Molecular Weight

Approximately 43.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2G2 Protein, Human (GST)
Cat. No.:
HY-P71401
Quantity:
MCE Japan Authorized Agent: