1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin Conjugating Enzyme E2 G1
  6. UBE2G1 Protein, Human

The UBE2G1 protein is an important participant in the ubiquitin-proteasome system, acting as an E2 ubiquitin-conjugating enzyme to promote the attachment of ubiquitin to different protein substrates. In vitro, UBE2G1 exhibits catalytic ability in “Lys-48” and “Lys-63” linked polyubiquitination reactions. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2G1 protein is an important participant in the ubiquitin-proteasome system, acting as an E2 ubiquitin-conjugating enzyme to promote the attachment of ubiquitin to different protein substrates. In vitro, UBE2G1 exhibits catalytic ability in “Lys-48” and “Lys-63” linked polyubiquitination reactions. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli , with tag free.

Background

UBE2G1, an essential player in the ubiquitin-proteasome system, serves as an E2 ubiquitin-conjugating enzyme, facilitating the covalent attachment of ubiquitin to diverse protein substrates. In vitro, UBE2G1 showcases its catalytic competence by catalyzing both 'Lys-48'- and 'Lys-63'-linked polyubiquitination reactions. This multifaceted enzyme is implicated in potential roles, including the degradation of muscle-specific proteins, highlighting its involvement in cellular processes related to protein turnover. Additionally, UBE2G1 demonstrates its functional relevance by mediating the polyubiquitination of CYP3A4, a cytochrome P450 enzyme involved in the metabolism of various substrates, underscoring its significance in regulating specific cellular pathways.

Biological Activity

Under ATP and E1 conditions, E2 covalently binds with ubiquitin molecules to form thioester complexes E2~Ub.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P62253 (M1-E170)

Gene ID
Molecular Construction
N-term
UBE2G1 (M1-E170)
Accession # P62253
C-term
Protein Length

Full Length

Synonyms
Ubiquitin-conjugating enzyme E2 G1; E217K; UBC7; UBE2G1; UBE2G
AA Sequence

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

Molecular Weight

Approximately 19.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2G1 Protein, Human
Cat. No.:
HY-P77271
Quantity:
MCE Japan Authorized Agent: