1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. UBE2D4
  6. UBE2D4 Protein, Human (GST)

The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.

Background

UBE2D4, a crucial component of the ubiquitin-proteasome system, operates as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UBE2D4 showcases its versatility by demonstrating the ability to promote polyubiquitination using all seven ubiquitin Lys residues, with a potential preference for 'Lys-11' and 'Lys-48'-linked polyubiquitination. This dynamic range of ubiquitin chain linkages suggests UBE2D4's involvement in diverse cellular processes and regulatory pathways, emphasizing its significance in the intricate network of protein degradation and turnover.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9Y2X8 (M1-M147)

Gene ID

51619  [NCBI]

Molecular Construction
N-term
GST
UBE2D4 (M1-M147)
Accession # Q9Y2X8
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 D4; HBUCE1; Ubiquitin Carrier Protein D4; Ubiquitin-Protein Ligase D4; UBE2D4; UBCH5D
AA Sequence

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Molecular Weight

Approximately 40.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UBE2D4 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2D4 Protein, Human (GST)
Cat. No.:
HY-P71400
Quantity:
MCE Japan Authorized Agent: