1. Recombinant Proteins
  2. Others
  3. TXNDC17 Protein, Human

TXNDC17 Protein is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. And it inhibits the pathways of NF-κB, mitogen-activated protein kinases, and apoptosis in cells stimulated with TNF-alpha. Furthermore, TXNDC17 is an efficient S-denitrosylase. TXNDC17 Protein, Human is the recombinant human-derived TXNDC17 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TXNDC17 Protein is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. And it inhibits the pathways of NF-κB, mitogen-activated protein kinases, and apoptosis in cells stimulated with TNF-alpha. Furthermore, TXNDC17 is an efficient S-denitrosylase. TXNDC17 Protein, Human is the recombinant human-derived TXNDC17 protein, expressed by E. coli , with tag free.

Background

Thioredoxin domain-containing protein 17 (TXNDC17) is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. TXNDC17 inhibits the pathways of nuclear factor-kappaB (NF-kappaB), mitogen-activated protein kinases, and apoptosis in cells stimulated with tumor necrosis factor-alpha (TNF-alpha). In addition, TXNDC17 is an efficient S-denitrosylase with similar efficiency as Trx1 in catalyzing TrxR1-dependent denitrosylation of S-nitrosylated glutathione or of HEK293 cell-derived S-nitrosoproteins[1][2].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

A0A140VJY7 (M1-D123)

Gene ID
Molecular Construction
N-term
TXNDC17 (M1-D123)
Accession # A0A140VJY7
C-term
Synonyms
Thioredoxin domain-containing protein 17; TRP14; Protein 42-9-9; TXNL5
AA Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Molecular Weight

Approximately 13.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TXNDC17 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXNDC17 Protein, Human
Cat. No.:
HY-P77268
Quantity:
MCE Japan Authorized Agent: