1. Recombinant Proteins
  2. Others
  3. TXNDC17 Protein, Human

TXNDC17 Protein is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. And it inhibits the pathways of NF-κB, mitogen-activated protein kinases, and apoptosis in cells stimulated with TNF-alpha. Furthermore, TXNDC17 is an efficient S-denitrosylase. TXNDC17 Protein, Human is the recombinant human-derived TXNDC17 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TXNDC17 Protein is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. And it inhibits the pathways of NF-κB, mitogen-activated protein kinases, and apoptosis in cells stimulated with TNF-alpha. Furthermore, TXNDC17 is an efficient S-denitrosylase. TXNDC17 Protein, Human is the recombinant human-derived TXNDC17 protein, expressed by E. coli , with tag free.

Background

Thioredoxin domain-containing protein 17 (TXNDC17) is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. TXNDC17 inhibits the pathways of nuclear factor-kappaB (NF-kappaB), mitogen-activated protein kinases, and apoptosis in cells stimulated with tumor necrosis factor-alpha (TNF-alpha). In addition, TXNDC17 is an efficient S-denitrosylase with similar efficiency as Trx1 in catalyzing TrxR1-dependent denitrosylation of S-nitrosylated glutathione or of HEK293 cell-derived S-nitrosoproteins[1][2].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

A0A140VJY7 (M1-D123)

Gene ID
Molecular Construction
N-term
TXNDC17 (M1-D123)
Accession # A0A140VJY7
C-term
Protein Length

Full Length

Synonyms
Thioredoxin domain-containing protein 17; TRP14; Protein 42-9-9; TXNL5
AA Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Molecular Weight

Approximately 13.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TXNDC17 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXNDC17 Protein, Human
Cat. No.:
HY-P77268
Quantity:
MCE Japan Authorized Agent: