1. Recombinant Proteins
  2. Others
  3. TXLNA Protein, Human (His)

The TXLNA protein may be involved in intracellular vesicle trafficking, specifically calcium-dependent exocytosis in neuroendocrine cells. Its binding kinetics involve interactions with the C-terminal coiled-coil region of synaptophysin family members such as STX1A, STX3A, and STX4A. TXLNA Protein, Human (His) is the recombinant human-derived TXLNA protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TXLNA protein may be involved in intracellular vesicle trafficking, specifically calcium-dependent exocytosis in neuroendocrine cells. Its binding kinetics involve interactions with the C-terminal coiled-coil region of synaptophysin family members such as STX1A, STX3A, and STX4A. TXLNA Protein, Human (His) is the recombinant human-derived TXLNA protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

TXLNA Protein emerges as a potential participant in intracellular vesicle traffic and may play a role in calcium-dependent exocytosis in neuroendocrine cells. Its interaction dynamics are characterized by binding to the C-terminal coiled coil region of syntaxin family members, including STX1A, STX3A, and STX4A. Notably, this binding occurs when these syntaxins are not complexed with SNAP25, VAMP2, or STXBP1, implying that TXLNA interacts specifically with syntaxins that are not part of the SNARE complex. The specificity of its interactions suggests a nuanced role in intracellular vesicle trafficking, potentially influencing neuroendocrine cell functions. Elucidating the precise mechanisms through which TXLNA modulates vesicle traffic and its involvement in calcium-dependent exocytosis could provide valuable insights into its functional significance in cellular processes related to neurotransmission and secretion.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

P40222 (M1-K162)

Gene ID
Molecular Construction
N-term
6*His
TXLNA (M1-K162)
Accession # P40222
6*His
C-term
Protein Length

Partial

Synonyms
Alpha-Taxilin; TXLNA; TXLN
AA Sequence

MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEK

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TXLNA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXLNA Protein, Human (His)
Cat. No.:
HY-P71392
Quantity:
MCE Japan Authorized Agent: