1. Recombinant Proteins
  2. Others
  3. TWSG1 Protein, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Background

TWSG1 protein is potentially involved in the formation of the dorsoventral axis. It appears to exert its function by counteracting BMP signaling through the formation of ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors. Interestingly, TWSG1 exhibits both anti-BMP and pro-BMP activities. It achieves the latter by cleaving and degrading CHRD, leading to the release of BMPs from the ternary complexes. This dual role suggests that TWSG1 may be a crucial regulator of BMP-mediated processes, particularly in cartilage development and chondrocyte differentiation. Additionally, it may also play a role in thymocyte development. TWSG1 interacts with CHRD and/or BMP4, enhancing the formation of CHRD/BMP4 complexes, and it also interacts with BMP7. Further investigations are needed to fully comprehend the precise mechanisms and signaling pathways through which TWSG1 operates.

Biological Activity

Measured by its ability to inhibit BMP-6-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.8289 µg/mL in the presence of 150 ng/mL of Recombinant Human BMP-6, corresponding to a specific activity is 1.206×103 U/mg.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9EP52 (C25-F222)

Gene ID
Molecular Construction
N-term
TWSG1 (C25-F222)
Accession # Q9EP52
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Twisted Gastrulation Protein Homolog 1; TWSG1; TSG
AA Sequence

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TWSG1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TWSG1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77267
Quantity:
MCE Japan Authorized Agent: