TUBB4A Protein, Human (His)

TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag.

The TUBB4A protein takes center stage as the primary component of microtubules, contributing to the formation of cylindrical structures through the lateral association of linear protofilaments composed of alpha- and beta-tubulin heterodimers. The dynamic growth of microtubules is facilitated by the addition of GTP-tubulin dimers to the microtubule end, resulting in the formation of a stabilizing cap. Below this cap, TUBB4A protein dimers transition to a GDP-bound state, a process regulated by the GTPase activity of alpha-tubulin. This intricate mechanism underscores the crucial role of TUBB4A in governing the assembly and stability of microtubules.

Human

E. coli

N-6*His

P04350 (M1-A444)

10382  [NCBI]

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Approximately 58.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.