1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. TTN Protein, Human (His)

The TTN protein is critical for vertebrate striated muscle assembly, establishing microfilament connections that are critical for sarcomeric force balance. TTN coordinates cross-link size and extensibility, shaping sarcomere extensibility and muscle function. TTN Protein, Human (His) is the recombinant human-derived TTN protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TTN protein is critical for vertebrate striated muscle assembly, establishing microfilament connections that are critical for sarcomeric force balance. TTN coordinates cross-link size and extensibility, shaping sarcomere extensibility and muscle function. TTN Protein, Human (His) is the recombinant human-derived TTN protein, expressed by E. coli , with N-His labeled tag.

Background

TTN, a crucial player in the assembly and operation of vertebrate striated muscles, assumes a pivotal role by establishing connections at the individual microfilament level. This contribution becomes instrumental in maintaining the delicate balance of forces within the sarcomere halves. The size and extensibility of the cross-links, orchestrated by TTN, emerge as key determinants shaping the extensibility properties of the sarcomere and, consequently, muscle function. Beyond its myocentric duties, TTN extends its influence to non-muscle cells, where it appears to participate in vital processes such as chromosome condensation and segregation during mitosis. In this context, TTN's potential roles include acting as a link between the lamina network and chromatin or nuclear actin, or potentially both, during the interphase of the cell cycle. This multifaceted engagement underscores TTN's significance in both muscle physiology and cellular dynamics.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8WZ42 (5398V-5604T)

Gene ID
Molecular Construction
N-term
His
TTN (5398V-5604T)
Accession # Q8WZ42
C-term
Synonyms
MPRM; Cardiomyopathy dilated 1G CMD1G; CMH 9; CMH9; CMPD 4; CMPD4; Connectin; HMERF; LGMD2J; MU RMS 40.14; MYLK5; TMD; TTN
AA Sequence

VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT

Molecular Weight

Approximately 26.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TTN Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TTN Protein, Human (His)
Cat. No.:
HY-P71698
Quantity:
MCE Japan Authorized Agent: