1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. TSTA3 Protein, Human (His)

The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.

Background

TSTA3, also known as GDP-L-fucose synthase, is an enzyme responsible for the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. This enzymatic process involves both an epimerase and a reductase reaction. In the first step, the epimerase activity facilitates the conversion of GDP-4-dehydro-6-deoxy-D-mannose to an intermediate, and in the subsequent reductase reaction, this intermediate is further reduced to yield GDP-fucose. GDP-fucose is a critical nucleotide sugar that serves as a precursor in the biosynthesis of fucosylated glycans. Fucosylation plays pivotal roles in various biological processes, including cell adhesion, immune response, and signaling. The catalytic function of TSTA3 in the synthesis of GDP-fucose highlights its importance in the regulation of glycan structures and their involvement in diverse cellular functions.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q13630 (M1-K321)

Gene ID
Molecular Construction
N-term
TSTA3 (M1-K321)
Accession # Q13630
6*His
C-term
Synonyms
GDP-L-Fucose Synthase; GDP-4-Keto-6-Deoxy-D-Mannose-3; 5-Epimerase-4-Reductase; Protein FX; Red Cell NADP(H)-Binding Protein; Short-Chain Dehydrogenase/Reductase Family 4E Member 1; TSTA3; SDR4E1
AA Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Molecular Weight

Approximately 40.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TSTA3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSTA3 Protein, Human (His)
Cat. No.:
HY-P71390
Quantity:
MCE Japan Authorized Agent: