1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. Tryptophan Synthase Protein, E.coli (His)

The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. Tryptophan Synthase Protein, E.coli (His) is a recombinant protein dimer complex containing E. coli-derived Tryptophan Synthase protein, expressed by E. coli , with N-6*His labeled tag. Tryptophan Synthase Protein, E.coli (His), has molecular weight of 28 & 40-50 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. Tryptophan Synthase Protein, E.coli (His) is a recombinant protein dimer complex containing E. coli-derived Tryptophan Synthase protein, expressed by E. coli , with N-6*His labeled tag. Tryptophan Synthase Protein, E.coli (His), has molecular weight of 28 & 40-50 kDa, respectively.

Background

The TrpA protein, with its alpha subunit, takes on the crucial role of catalyzing the aldol cleavage of indoleglycerol phosphate, yielding indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the functional significance of TrpA in the tryptophan biosynthesis pathway, contributing to the generation of essential components for cellular processes. The alpha subunit's specific involvement in this cleavage reaction underscores its role as a key catalyst in the intricate biochemical machinery governing the synthesis of tryptophan in various biological contexts.

Species

E.coli

Source

E. coli

Tag

N-6*His

Accession

P0A877 (M1-S268)&P0A879 (T2-I397)

Gene ID

946204  [NCBI]&945768  [NCBI]

Molecular Construction
N-term
6*His
trpA (M1-S268)
Accession # P0A877
C-term
N-term
trpB (T2-I397)
Accession # P0A879
C-term
Synonyms
Tryptophan synthetase; Tryptophan synthase
AA Sequence

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS&TTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALTKCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGMFADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQLLVVNLSGRGDKDIFTVHDILKARGEI

Molecular Weight

29&40-50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Tryptophan Synthase Protein, E.coli (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tryptophan Synthase Protein, E.coli (His)
Cat. No.:
HY-P71098
Quantity:
MCE Japan Authorized Agent: