1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators
  3. Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. Trk Receptors TrkA
  5. TrkA Protein, Human (HEK293, His)

Pentraxin 3/TSG-14 protein is a multifunctional protein that plays a role in immune response and inflammation. It is involved in the recognition and clearance of pathogens, as well as regulation of inflammatory processes. Dysregulation of Pentraxin 3/TSG-14 protein has been associated with various diseases, including cardiovascular disorders and infections. Targeting Pentraxin 3/TSG-14 protein may hold therapeutic potential in these conditions. TrkA Protein, Human (HEK293, His) is the recombinant human-derived TrkA protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pentraxin 3/TSG-14 protein is a multifunctional protein that plays a role in immune response and inflammation. It is involved in the recognition and clearance of pathogens, as well as regulation of inflammatory processes. Dysregulation of Pentraxin 3/TSG-14 protein has been associated with various diseases, including cardiovascular disorders and infections. Targeting Pentraxin 3/TSG-14 protein may hold therapeutic potential in these conditions. TrkA Protein, Human (HEK293, His) is the recombinant human-derived TrkA protein, expressed by HEK293 , with N-His labeled tag.

Background

The TrkA Protein, a member of the neurotrophic tyrosine kinase receptor (NTKR) family, encodes a membrane-bound receptor that, upon neurotrophin binding, initiates phosphorylation of itself and members of the MAPK pathway. This kinase's presence facilitates cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been linked to congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability, and cancer. Several alternate transcriptional splice variants of this gene have been identified, but only three have been characterized to date. The gene demonstrates biased expression, with higher levels detected in the adrenal (RPKM 3.7), testis (RPKM 1.0), and 10 other tissues, suggesting its potential significance in various physiological contexts across multiple organs.

Biological Activity

Measured by its ability to inhibit NGF-induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 0.06643 μg/mL, corresponding to a specific activity is 1.51×10^4 units/mg.

Species

Human

Source

HEK293

Tag

N-His

Accession

NP_002520.2 (P194-E413)

Gene ID
Molecular Construction
N-term
His
TrkA (P194-E413)
Accession # NP_002520.2
C-term
Protein Length

Partial

Synonyms
High affinity nerve growth factor receptor; Trk-A; NTRK1; MTC; TRK
AA Sequence

PTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDE

Molecular Weight

35-60 kDa

Glycosylation
Yes
Purity
  • Measured by its ability to inhibit NGF-induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 0.06643 μg/mL, corresponding to a specific activity is 1.51×104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TrkA Protein, Human (HEK293, His)
Cat. No.:
HY-P73457
Quantity:
MCE Japan Authorized Agent: