1. Recombinant Proteins
  2. Others
  3. TREM-2 Protein, Human (HEK293, His)

TREM-2 Protein is a receptor for amyloid beta protein 42, lipoprotein particles, and apolipoprotein. TREM-2 Protein is involved in cell proliferation and apoptosis through Wnt/β, MTOR, PI3K and NF-kappa-B signaling pathways. TREM-2 Protein is expressed by macrophages, immature monocyte-derived dendritic cells, osteoclasts, and microglia to activate the immune response. TREM-2 Protein, Human (HEK293, His) is the recombinant human-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TREM-2 Protein is a receptor for amyloid beta protein 42, lipoprotein particles, and apolipoprotein. TREM-2 Protein is involved in cell proliferation and apoptosis through Wnt/β, MTOR, PI3K and NF-kappa-B signaling pathways. TREM-2 Protein is expressed by macrophages, immature monocyte-derived dendritic cells, osteoclasts, and microglia to activate the immune response. TREM-2 Protein, Human (HEK293, His) is the recombinant human-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Triggering receptor expressed on myeloid cells 2 (TREM-2) can form a receptor signaling complex with TYROBP, mediating signaling and cell activation after ligand binding. TREM-2 is a receptor for amyloid beta protein 42 and mediates its uptake and degradation by microglia. Binding to amyloid-β42 mediates microglia activation, proliferation, migration, apoptosis and the expression of pro-inflammatory cytokines such as IL6R, CCL3 and anti-inflammatory cytokine ARG1. TREM-2 is a receptor for lipoprotein particles (such as LDL, VLDL, and HDL) and apolipoproteins (such as APOA1, APOA2, APOB, APOE, APOE2, APOE3, APOE4, and CLU) and enhances their uptake in microglia. TREM-2 acts as an upstream regulator of the Wnt/ beta-catenin signaling cascade to regulate microglial cell proliferation. TREM-2 acts on the metabolism of microglia by activating MTOR. TREM-2 inhibited the response of PI3K and NF-kappa-B signals to lipopolysaccharide. It can promote phagocytosis, inhibit the production of proinflammatory cytokines and nitric oxide, inhibit cell apoptosis, and increase the expression of IL10 and TGFB. During oxidative stress, it promotes anti-apoptotic NF-kappa-B signaling and ERK signaling. TREM-2 can trigger immune response activation of macrophages and dendritic cells mediating cytokine-induced fusion of macrophages to form multinucleated giant cells, and in dendritic cells mediating upregulation of chemokine receptor CCR7 and maturation and survival of dendritic cells[1][2][3][4][5][6].

Biological Activity

Immobilized Human TREM-2, at 1 μg/mL (100 μL/well) can bind Anti-TREM2 Antibody. The ED50 is 30.5 ng/mL, corresponding to a specific activity is 3.28×10^4 units/mg.

  • Immobilized Human TREM-2, at 1 μg/mL (100 μL/well) can bind Anti-TREM2 Antibody,  The ED50 for this effect is 30.5 ng/mL, corresponding to a specific activity is 3.28×104units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NZC2-1 (H19-S174)

Gene ID
Molecular Construction
N-term
TREM-2 (H19-S174)
Accession # Q9NZC2-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Triggering receptor expressed on myeloid cells 2; TREM-2; Triggering receptor expressed on monocytes 2; TREM2
AA Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Molecular Weight

22-40 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TREM-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREM-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70534
Quantity:
MCE Japan Authorized Agent: