1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. TREM-1/CD354
  5. TREM-1 Protein, Human (HEK293, His)

The TREM-1 protein is a cell surface receptor that critically regulates innate and adaptive immunity by enhancing inflammatory responses. TREM-1 plays a crucial role in acute and chronic inflammatory diseases, acting as a decoy receptor to balance its pro-inflammatory effects. TREM-1 Protein, Human (HEK293, His) is the recombinant human-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TREM-1 protein is a cell surface receptor that critically regulates innate and adaptive immunity by enhancing inflammatory responses. TREM-1 plays a crucial role in acute and chronic inflammatory diseases, acting as a decoy receptor to balance its pro-inflammatory effects. TREM-1 Protein, Human (HEK293, His) is the recombinant human-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TREM-1 protein, as a cell surface receptor, potentially participates in innate and adaptive immune responses. Following phosphorylation, it interacts with PTPN6 and PTPN11, indicating its role in signaling pathways linked to these phosphatases. This interaction highlights the regulatory mechanisms TREM-1 may contribute to in modulating the immune system.

Biological Activity

Measured by its ability to block anti-TREM-1-induced TNF-alpha secretion by human myeloid leukemia mononuclear cells. At 1 µg/mL, Recombinant Human TREM-1 is able to block is 63% of Anti-Human TREM-1 (20 µg/mL, 200 µL/well) induced TNF-alpha released from 1 x 105 cells.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NP99-1 (A21-R200)

Gene ID
Molecular Construction
N-term
TREM-1 (A21-R200)
Accession # Q9NP99-1
6*His
C-term
Protein Length

Partial

Synonyms
Triggering Receptor Expressed on Myeloid Cells 1; TREM-1; Triggering Receptor Expressed on Monocytes 1; CD354; TREM1
AA Sequence

ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR

Molecular Weight

26-40 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREM-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71380
Quantity:
MCE Japan Authorized Agent: