1. Recombinant Proteins
  2. TRDC Protein, Human (HEK293, His)

TRDC Protein, Human (HEK293, His) is the recombinant human-derived TRDC protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRDC Protein, Human (HEK293, His) is the recombinant human-derived TRDC protein, expressed by HEK293, with C-His tag.

Background

TRDC is the constant region of the T cell receptor (TR) delta chain involved in antigen recognition. Gamma-delta TRs recognize diverse self and foreign non-peptide antigens, often expressed at epithelial host-environment interfaces, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Antigen recognition triggers rapid, innate-like immune responses for pathogen clearance and tissue repair. Binding of gamma-delta TR complex to antigen induces phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains by LCK and FYN kinases, recruiting and activating ZAP70 to phosphorylate scaffolding proteins LCP2 and LAT. This forms a supramolecular signalosome recruiting phospholipase PLCG1, leading to calcium mobilization and ERK activation, ultimately driving T cell expansion and effector differentiation. Gamma-delta TRs are generated through somatic rearrangement of limited variable (V), diversity (D), and joining (J) gene segments. Their diversity stems from tandem (D) gene rearrangement and utilization of all three reading frames, further enhanced by exonuclease trimming and random nucleotide (N) additions during V-(D)-J recombination.

Species

Human

Source

HEK293

Tag

C-His

Accession

B7Z8K6 (S1-V129)

Gene ID

/

Molecular Construction
N-term
TRDC (S1-V129)
Accession # B7Z8K6
His
C-term
Protein Length

Partial

Synonyms
TRDC
AA Sequence

SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTV

Predicted Molecular Mass
16.4 kDa
Molecular Weight

Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRDC Protein, Human (HEK293, His)
Cat. No.:
HY-P704154
Quantity:
MCE Japan Authorized Agent: