1. Recombinant Proteins
  2. Biotinylated Proteins Others
  3. TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi)

TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P704152
Handling Instructions Technical Support

TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.

Background

TRBC2 is the constant region of the T cell receptor (TR) beta chain (PubMed:24600447). Alpha-beta T cell receptors are antigen-specific receptors essential for immune responses and are expressed on the surface of T lymphocytes. They recognize peptide-major histocompatibility (pMH) complexes displayed by antigen-presenting cells (APCs), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH triggers TR-CD3 clustering on the cell surface and intracellular activation of LCK, which phosphorylates ITAM motifs in CD3G, CD3D, CD3E, and CD247, enabling ZAP70 recruitment. ZAP70 then phosphorylates LAT, forming the LAT signalosome that recruits multiple signaling molecules, branching into three major pathways: calcium signaling, mitogen-activated protein kinase (MAPK), and nuclear factor NF-kappa-B (NF-κB). These pathways mobilize transcription factors critical for gene expression, T cell growth, and differentiation (PubMed:23524462). The T cell receptor repertoire is generated in the thymus via V-(D)-J rearrangement and shaped by intrathymic selection to produce a peripheral T cell pool with self-MHC restriction and non-autoaggressive properties. Post-thymic interactions between alpha-beta TR and pMH further refine TR structural and functional avidity (PubMed:15040585).

Species

Human

Source

HEK293

Tag

C-His;C-Avi

Accession

A0A5B9 (D1-A144)

Gene ID

/

Molecular Construction
N-term
TRBC2 (D1-A144)
Accession # A0A5B9
His-Avi
C-term
Protein Length

Partial

Synonyms
T cell receptor beta constant 2; TRBC2
AA Sequence

DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

Predicted Molecular Mass
20.0 kDa
Molecular Weight

Approximately 21-22 kDa & 25 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P704152
Quantity:
MCE Japan Authorized Agent: