1. Recombinant Proteins
  2. Others
  3. TRGC1 Protein, Human (HEK293, His)

TRBC1 Protein, Human (HEK293, His) is the recombinant human-derived TRBC1 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRBC1 Protein, Human (HEK293, His) is the recombinant human-derived TRBC1 protein, expressed by HEK293, with C-His tag.

Background

TRBC1 is the constant region of the T cell receptor (TR) gamma chain involved in antigen recognition. Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens, often expressed at epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition, TRBC1 triggers rapid, innate-like immune responses for pathogen clearance and tissue repair. Binding of the gamma-delta TR complex to antigen induces phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains by LCK and FYN kinases, recruiting and activating ZAP70, which facilitates phosphorylation of scaffolding proteins LCP2 and LAT. This leads to the formation of a supramolecular signalosome that recruits phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately driving T cell expansion and differentiation into effector cells. Gamma-delta TRs are generated through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes, with diversity enhanced by tandem (D) gene rearrangement, utilization of all three reading frames, and exonuclease trimming and random nucleotide (N) region additions during V-(D)-J recombination.

Species

Human

Source

HEK293

Tag

C-His

Accession

P0CF51 (D1-A138)

Gene ID

/

Molecular Construction
N-term
TRGC1 (D1-A138)
Accession # P0CF51
His
C-term
Protein Length

Partial

Synonyms
TRGC1; T cell receptor gamma constant 1
AA Sequence

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLLLQLTNTSA

Predicted Molecular Mass
17.6 kDa
Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TRGC1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRGC1 Protein, Human (HEK293, His)
Cat. No.:
HY-P704153
Quantity:
MCE Japan Authorized Agent: