TRGC1 Protein, Human (HEK293, His)

TRBC1 Protein, Human (HEK293, His) is the recombinant human-derived TRBC1 protein, expressed by HEK293, with C-His tag.

TRBC1 is the constant region of the T cell receptor (TR) gamma chain involved in antigen recognition. Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens, often expressed at epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition, TRBC1 triggers rapid, innate-like immune responses for pathogen clearance and tissue repair. Binding of the gamma-delta TR complex to antigen induces phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains by LCK and FYN kinases, recruiting and activating ZAP70, which facilitates phosphorylation of scaffolding proteins LCP2 and LAT. This leads to the formation of a supramolecular signalosome that recruits phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately driving T cell expansion and differentiation into effector cells. Gamma-delta TRs are generated through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes, with diversity enhanced by tandem (D) gene rearrangement, utilization of all three reading frames, and exonuclease trimming and random nucleotide (N) region additions during V-(D)-J recombination.

Human

HEK293

C-His

P0CF51 (D1-A138)

/

Partial

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLLLQLTNTSA

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.