1. Recombinant Proteins
  2. Others
  3. TRAT1 Protein, Human (His)

TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

T Cell Receptor-Associated Transmembrane Adaptor 1 (TRAT1) protein functions as a stabilizer for the T-cell antigen receptor (TCR)/CD3 complex on the surface of T-cells. Existing as a homodimer through disulfide linkages, TRAT1 engages in interactions with CD3Z, contributing to the structural integrity and proper functioning of the TCR/CD3 complex. Upon phosphorylation, TRAT1 further interacts with PIK3R1, suggesting its involvement in signaling pathways associated with T-cell activation and response.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q6PIZ9 (N29-N186)

Gene ID
Molecular Construction
N-term
TRAT1 (N29-N186)
Accession # Q6PIZ9
6*His
C-term
Protein Length

Cytoplasmic Domain

Synonyms
T-Cell Receptor-Associated Transmembrane Adapter 1; T-Cell Receptor-Interacting Molecule; TRIM; pp29/30; TRAT1; TCRIM; HSPC062
AA Sequence

NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

Molecular Weight

Approximately 30.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 20% glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TRAT1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAT1 Protein, Human (His)
Cat. No.:
HY-P71379
Quantity:
MCE Japan Authorized Agent: