1. Recombinant Proteins
  2. Others
  3. Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc)

Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc)

Cat. No.: HY-P71671
Handling Instructions Technical Support

Transthyretin (TTR) is a thyroid hormone-binding protein that may be involved in transporting thyroxine from the blood to the brain. As a homotetramer, TTR forms a dimer of dimers with a ligand-regulated central channel. Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc) is the recombinant cynomolgus-derived Transthyretin/TTR protein, expressed by HEK293 , with N-6*His, N-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Transthyretin (TTR) is a thyroid hormone-binding protein that may be involved in transporting thyroxine from the blood to the brain. As a homotetramer, TTR forms a dimer of dimers with a ligand-regulated central channel. Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc) is the recombinant cynomolgus-derived Transthyretin/TTR protein, expressed by HEK293 , with N-6*His, N-Myc labeled tag.

Background

Transthyretin (TTR), a thyroid hormone-binding protein, is implicated in the likely transport of thyroxine from the bloodstream to the brain. Structurally organized as a homotetramer, TTR forms a dimer of dimers, where subunits assemble around a central channel capable of accommodating two ligand molecules. The intricate architecture of the homotetramer suggests a functional role in facilitating the transport of thyroid hormones. Additionally, TTR interacts with RBP4, further highlighting its involvement in complex molecular interactions and potential roles in thyroid hormone regulation.

Biological Activity

Measured in a cell proliferation assay using A549 cells. The ED50 this effect is 1.794 ng/mL, corresponding to a specific activity is 5.57×105 units/mg.

  • Measured in a cell proliferation assay using A549 cells. The ED50 this effect is 1.794 ng/mL, corresponding to a specific activity is 5.57×105 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

N-6*His;N-Myc

Accession

Q8HXW1 (G21-E147)

Gene ID
Molecular Construction
N-term
6*His-Myc
TTR (G21-E147)
Accession # Q8HXW1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
TTR; QccE-10711; QccE-14396; Transthyretin; Prealbumin
AA Sequence

GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Molecular Weight

Approximately 18 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc)
Cat. No.:
HY-P71671
Quantity:
MCE Japan Authorized Agent: