1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Transmembrane protease serine 4 Protein, Mouse (His-SUMO)

Transmembrane protease serine 4 Protein, Mouse (His-SUMO)

Cat. No.: HY-P71604
Handling Instructions Technical Support

The transmembrane protease serine 4 (TMPRSS4) protein is a plasma membrane-anchored serine protease that is critical for activating molecular pathways. Its proteolytic activity directly processes pro-uPA/PLAU into its active form. Transmembrane protease serine 4 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Transmembrane protease serine 4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The transmembrane protease serine 4 (TMPRSS4) protein is a plasma membrane-anchored serine protease that is critical for activating molecular pathways. Its proteolytic activity directly processes pro-uPA/PLAU into its active form. Transmembrane protease serine 4 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Transmembrane protease serine 4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

The Transmembrane Protease Serine 4 (TMPRSS4) Protein, a plasma membrane-anchored serine protease, plays a pivotal role in the activation of various molecular pathways. Through its proteolytic activity, TMPRSS4 directly induces the processing of pro-uPA/PLAU, converting it into its active form. Additionally, TMPRSS4 exhibits the capability to activate epithelial sodium channels (ENaC). This dual functionality underscores the significance of TMPRSS4 in regulating crucial cellular processes, emphasizing its potential impact on protease-mediated cascades and ion channel activation in diverse physiological contexts.

Species

Mouse

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q8VCA5 (K52-M435)

Gene ID
Molecular Construction
N-term
6*His-SUMO
Tmprss4 (K52-M435)
Accession # Q8VCA5
C-term
Protein Length

Extracellular Domain

Synonyms
Tmprss4; Cap2; Transmembrane protease serine 4; EC 3.4.21.-; Channel-activating protease 2; mCAP2
AA Sequence

KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM

Predicted Molecular Mass
57.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Transmembrane protease serine 4 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Transmembrane protease serine 4 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71604
Quantity:
MCE Japan Authorized Agent: