1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Death Receptor 5
  6. TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His-Fc)

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His-Fc)

Cat. No.: HY-P72977
Handling Instructions Technical Support

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC).It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC).It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

TRAIL R2/TNFRSF10B Protein serves as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon ligand binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, leading to the formation of the death-inducing signaling complex (DISC). The DISC performs caspase-8 proteolytic activation, initiating a cascade of caspases that mediate apoptosis. Additionally, TRAIL R2/TNFRSF10B promotes the activation of NF-kappa-B and is essential for ER stress-induced apoptosis. In its monomeric form, it can interact with TRADD and RIPK1, and three TNFRSF10B molecules interact with the TNFSF10 homotrimer. In the absence of stimulation, TRAIL R2/TNFRSF10B interacts with BIRC2, DDX3X, and GSK3B, with enhanced interactions observed upon receptor stimulation, accompanied by DDX3X and BIRC2 cleavage (By similarity).

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

Q9QZM4 (N53-S177)

Gene ID
Molecular Construction
N-term
TRAIL-R2 (N53-S177)
Accession # Q9QZM4
hFc-His
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; CD262; Tnfrsf10b; Dr5; Killer
AA Sequence

MEPPGPSTPTASAAARADHYTPGLRPLPKRRLLYSFALLLAVLQAVFVPVTANPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Weight

50-55 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P72977
Quantity:
MCE Japan Authorized Agent: