1. Recombinant Proteins
  2. Others
  3. TPP2 Protein, Human (Myc, His)

TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

The cytosolic tripeptidyl-peptidase TPP2 protein functions as a key component of the proteolytic cascade in the ubiquitin-proteasome pathway, acting downstream of the 26S proteasome. It plays a crucial role in intracellular amino acid homeostasis, functioning to release N-terminal tripeptides from polypeptides. Additionally, TPP2 protein has been implicated in stimulating adipogenesis, contributing to cellular processes involved in adipose tissue formation.

Species

Human

Source

E. coli

Tag

N-His;C-Myc

Accession

P29144 (44D-264H)

Gene ID
Molecular Construction
N-term
10*His
TPP2 (44D-264H)
Accession # P29144
Myc
C-term
Protein Length

Partial

Synonyms
TPP2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II
AA Sequence

DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

Predicted Molecular Mass
31.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TPP2 Protein, Human (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPP2 Protein, Human (Myc, His)
Cat. No.:
HY-P71451
Quantity:
MCE Japan Authorized Agent: