TNFRSF13B Protein, Human (HEK293, Fc)

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human (HEK293, Fc) is the recombinant human-derived TNFRSF13B protein, expressed by HEK293 , with C-hFc labeled tag.

TNFRSF13B Protein serves as the receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS, demonstrating high-affinity binding to both ligands. Its activation results in calcineurin-dependent activation of NF-AT, along with the activation of NF-kappa-B and AP-1, thereby playing a crucial role in stimulating B- and T-cell function and regulating humoral immunity. Additionally, TNFRSF13B binds TRAF2, TRAF5, and TRAF6, suggesting its involvement in various signaling pathways. Notably, it interacts with the NH2-terminal domain of CAMLG using its C-terminus.

Human

HEK293

C-hFc

O14836-1 (S2­T166)

23495  [NCBI]

Extracellular Domain

SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST

50-54 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.