TNFRSF12A Protein, Human

TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human is the recombinant human-derived TNFRSF12A protein, expressed by E. coli , with tag free.

TNFRSF12A Protein serves as the receptor for TNFSF12/TWEAK and, in certain cell types, acts as a weak inducer of apoptosis. Moreover, it plays a role in promoting angiogenesis and endothelial cell proliferation, and it may modulate cellular adhesion to matrix proteins. The protein associates with TRAF1 and TRAF2, and potentially with TRAF3, indicating its involvement in various cellular signaling pathways.

Measured by its binding ability in a functional ELISA. Immobilized TNFRSF12A Protein, Human at 2 μg/mL (100 μL/well) can bind TWEAK/TNFSF12 Protein, Human (HY-P701045). The ED₅₀ for this effect is 0.08974 μg/mL.

Human

E. coli

Tag Free

Q9NP84-1 (E28-P80)

51330  [NCBI]

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.