1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily Macrophage CD Proteins
  4. TNF Receptor Superfamily RANK/CD265
  5. RANK/CD265
  6. RANK/TNFRSF11A Protein, Human

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

Background

The RANK/TNFRSF11A protein functions as the receptor for TNFSF11/RANKL/TRANCE/OPGL, playing a crucial role in the essential process of RANKL-mediated osteoclastogenesis. Interacting with EEIG1, it promotes osteoclast formation by facilitating the transcription of NFATC1 and activating PLCG2. Beyond its role in bone metabolism, RANK/TNFRSF11A is involved in regulating interactions between T-cells and dendritic cells. The protein binds to the clefts between the subunits of the TNFSF11 ligand trimer, forming a heterohexamer. It is also a key component of a complex comprising EEIG1, TNFRSF11A/RANK, PLCG2, GAB2, TEC, and BTK, with complex formation increasing in the presence of TNFSF11/RANKL. Additionally, RANK/TNFRSF11A interacts with TRAF family members (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) and GAB2, further contributing to its regulatory functions in diverse cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED50 for this effect is 7.235 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human RANK/TNFRSF11A at 2 μg/mL (100 μL/well) can bind Human RANKL/TNFSF11, Human (HY-P73387). The ED50 for this effect is 7.235 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9Y6Q6-1 (Q29-K202)

Gene ID
Molecular Construction
N-term
RANK (Q29-K202)
Accession # Q9Y6Q6-1
C-term
Protein Length

Partial

Synonyms
CD 265; CD265; FEO; LOH18CR1; Loss of heterozygosity 18 chromosomal region 1; mRANK; ODFR; OFE; OPTB7; Osteoclast differentiation factor receptor; OSTS; Paget disease of bone 2; PDB 2; PDB2; RANK; Receptor activator of NF KB; Receptor activator of NF-KB; receptor activator of nuclear factor kappa B; TNF receptor superfamily member 11a; TNFRSF11A; TNR11_HUMAN; TRANCER; Tumor necrosis factor receptor superfamily member 11a NFKB activator; Tumor necrosis factor receptor superfamily member 11a activator of NFKB; Tumor necrosis factor receptor superfamily member 11A
AA Sequence

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Predicted Molecular Mass
19.1 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RANK/TNFRSF11A Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANK/TNFRSF11A Protein, Human
Cat. No.:
HY-P71912
Quantity:
MCE Japan Authorized Agent: