TNF RII/TNFRSF1B Protein, Human (183a.a)

The TNFRII protein is a receptor with high affinity for TNFSF2/TNF-α and low affinity for TNFSF1/lymphotoxin-α, and plays a key role in mediating the metabolic effects of TNF-α. The TRAF1/TRAF2 complex recruits BIRC2 and BIRC3 to TNFRSF1B/TNFR2 to regulate the apoptotic pathway. TNFRII Protein, Human (183a.a) is the recombinant human-derived TNFRII protein, expressed by E. coli , with tag free.

The TNFRII protein serves as a receptor with a high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2, thereby modulating apoptotic pathways. This receptor plays a pivotal role in mediating the majority of the metabolic effects induced by TNF-alpha. Notably, its isoform 2 exhibits the ability to block TNF-alpha-induced apoptosis, suggesting a regulatory role in antagonizing the biological activity of TNF-alpha. Furthermore, TNFRII binds to TRAF2, highlighting its involvement in downstream signaling cascades. Additionally, interactions with BMX and the activated form of XPNPEP3 further contribute to the complexity of its molecular associations.

Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 0.125 μg/mL in the presence of 1.25 ng/mL of recombinant Human TNF-alpha. Corresponding to a specific activity is 8×10^3U/mg.

Human

E. coli

Tag Free

P20333-1 (P24-T206)

7133  [NCBI]

Partial

PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.