1. Recombinant Proteins
  2. Receptor Proteins
  3. TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc)

TNFRH3/TNFRSF26 protein is significantly expressed in the thymus and spleen, indicating that it plays a crucial role in regulating immune system function. Its presence in the thymus, a key organ for T-cell development, underscores its important role in overseeing fundamental cellular processes required for immune maturation. TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRH3/TNFRSF26 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFRH3/TNFRSF26 protein is significantly expressed in the thymus and spleen, indicating that it plays a crucial role in regulating immune system function. Its presence in the thymus, a key organ for T-cell development, underscores its important role in overseeing fundamental cellular processes required for immune maturation. TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRH3/TNFRSF26 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The TNFRH3/TNFRSF26 protein, a member of the tumor necrosis factor receptor superfamily, is expressed in key immune organs, including the thymus and spleen. This receptor, is also detectable at notable levels in the lung. As part of the tumor necrosis factor receptor family, TNFRH3 likely plays a role in mediating immune responses and cellular processes associated with inflammation. The specific expression pattern in immune-related organs and the presence in the lung indicate its potential involvement in immune regulation and surveillance, underscoring its significance in maintaining immune homeostasis and responding to external stimuli. Further exploration of TNFRH3's functions could shed light on its precise role in immune modulation and potential implications for health and disease.

Biological Activity

Immobilized Recombinant Mouse TNFRH3 at 2μg/mL (100 μL/well) can bind Recombinant Mouse TRAIL/TNFSF10. The ED50 for this effect is 248.6 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P83626/NP_783580.1 (S20-K162)

Gene ID

244237  [NCBI]

Molecular Construction
N-term
TNFRH3 (S20-K162)
Accession # P83626/NP_783580.1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor necrosis factor receptor superfamily member 26; TNF receptor homolog 3; Tnfrh3
AA Sequence

SVNTITLCKIGEFKHENLCCLQCSAGTYLRNPCQENHNKSECAPCDSEHFIDHKNRESECFPCSVCRDDQEEVAKCSRTADRVCQCKQGTYCDSENCLERCHTCSSCPDGRVVRKCNATMDTVCDKFDSEPGQSGSQCFCFSK

Molecular Weight

Approximately 45-50 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77500
Quantity:
MCE Japan Authorized Agent: