1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily TNF-RI/CD120a
  5. TNF-RI/CD120a
  6. TNF RI/TNFRSF1A Protein, Human (HEK293, His)

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag.

Background

TNFRSF1A (TNF RI) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRSF1A is the major signaling receptor for TNF-α. TNFRSF1A protein is a multifunctional cytokine, which is synthesized by almost all cells[1][2].
The sequence of amino acids in TNFRSF1A from different species is very different (less than 85% similarity among human, rat and mouse).
TNFRSF1A contains a protein-protein interaction domain, called death domain (DD), can recruit other DD-containing proteins and couples the death receptors to caspase activation and apoptosis. Both soluble and membrane-bound forms of the cytokine can activate TNFRSF1A. TNFRSF1A induces cellular inflammatory damage and apoptosis by participating in mTOR, JNK, IKK, caspase 3, MAPK, and NF-κB pathways[1][3][4].

Biological Activity

1.Measured  by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929  mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin  D.The 50 for this effect is ≤0.06164 μg/mLin the presence of 0.25 ng/mL of  recombinant humanTNF-alpha, corresponding to a specific activity is ≥1.622×104 units/mg.
2.Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human, can bind TNF-α, Human with an affinity constant of 0.106 nM as determined in SPR assay.

  • Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.06164 μg/mLin the presence of 0.25ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.622×104 units/mg.
Species

Human

Source

HEK293

Tag

C-8*His

Accession

P19438-1 (L30-T211)

Gene ID
Molecular Construction
N-term
TNFR-1 (L30-T211)
Accession # P19438-1
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A
AA Sequence

LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Molecular Weight

28-38kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TNF RI/TNFRSF1A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF RI/TNFRSF1A Protein, Human (HEK293, His)
Cat. No.:
HY-P700263
Quantity:
MCE Japan Authorized Agent: