1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. TNF-alpha/TNFSF2 Protein, Pig (N-His)

TNF-α/TNFSF2 protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and has multiple biological functions. It has the ability to induce cell death in specific tumor cell lines, serves as a potent pyrogen, can cause fever through direct action or stimulation of interleukin-1 secretion, and is involved in the induction of cachexia. TNF-alpha/TNFSF2 Protein, Pig (N-His) is the recombinant Pig-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TNF-alpha/TNFSF2 Protein, Pig (N-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-α/TNFSF2 protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and has multiple biological functions. It has the ability to induce cell death in specific tumor cell lines, serves as a potent pyrogen, can cause fever through direct action or stimulation of interleukin-1 secretion, and is involved in the induction of cachexia. TNF-alpha/TNFSF2 Protein, Pig (N-His) is the recombinant Pig-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, predominantly secreted by macrophages and exhibiting diverse biological functions. It possesses the capability to induce cell death in specific tumor cell lines, serving as a potent pyrogen that can cause fever through direct action or by stimulating interleukin-1 secretion, and is implicated in the induction of cachexia. Under certain conditions, TNF-alpha/TNFSF2 can play a role in both stimulating cell proliferation and inducing cell differentiation. It also contributes to insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, with additional effects on GKAP42 protein degradation. Furthermore, TNF-alpha/TNFSF2 participates in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and promotes osteoclastogenesis, thereby mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, further highlighting its multifaceted impact on diverse cellular processes.

Biological Activity

Measured in a cytotoxicity assay using TNF-susceptible PK-15 porcine kidney epithelial cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.06386 ng/mL, corresponding to a specific activity is 1.57×10^7 units/mg.

  • Measured in a cytotoxicity assay using TNF-susceptible PK-15 porcine kidney epithelial cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.06386 ng/mL,corresponding to a specific activity is 1.57×107 units/mg.
Species

Pig

Source

E. coli

Tag

N-6*His

Accession

P23563 (R78-L232)

Gene ID

397086

Molecular Construction
N-term
6*His
TGF-α (R78-L232)
Accession # P23563
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor; TNF; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; Tumor Necrosis Factor alpha; TNFA; TNFSF2
AA Sequence

RSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

Predicted Molecular Mass
17 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Pig (N-His)
Cat. No.:
HY-P700283
Quantity:
MCE Japan Authorized Agent: