1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. TNF-alpha/TNFSF2 Protein, Mouse (His)

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag.TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag.TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

Background

Tumor necrosis factor-α (TNF-α) is a pleiotropic cytokine produced by a wide variety of cell types of mostly hematopoietic, but also of nonhematopoietic, origin. TNFα is instrumental in the immune elimination of various infectious agents such as Candida albicans, Listeria monocytogenes, or mycobacteria and exerts potent proinflammatory effects, e.g. by inducing the expression of adhesion molecules such as VCAM-1, intercellular adhesion molecule 1 (ICAM-1), or E-selectin on endothelial cells and other cell types[1][2].

Biological Activity

The ED50 is ≤0.06 ng/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of ≥1.7 × 107 units/mg.

  • The ED50 is <0.05 ng/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of >2 × 107 units/mg.
Species

Mouse

Source

E. coli

Tag

N-His

Accession

P06804 (L80-L235)

Gene ID
Molecular Construction
N-term
His
TGF-α (L80-L235)
Accession # P06804
C-term
Protein Length

Full Length of TNF soluble form

Synonyms
rMuTNF-α, His; Cachectin; TNFSF2
AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Weight

Approximately 18.3 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Mouse (His)
Cat. No.:
HY-P7417
Quantity:
MCE Japan Authorized Agent: