1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. TNF-alpha/TNFSF2 Protein, Marmota monax (sf9, His)

TNF-alpha/TNFSF2 Protein, Marmota monax (sf9, His)

Cat. No.: HY-P700504
Handling Instructions Technical Support

TNF-α/TNFSF2 protein is a cytokine secreted by macrophages that binds TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, acts as a potent pyrogen causing fever, and is associated with cachexia induction. TNF-alpha/TNFSF2 Protein, Marmota monax (sf9, His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by sf9 insect cells , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-α/TNFSF2 protein is a cytokine secreted by macrophages that binds TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, acts as a potent pyrogen causing fever, and is associated with cachexia induction. TNF-alpha/TNFSF2 Protein, Marmota monax (sf9, His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by sf9 insect cells , with N-10*His labeled tag.

Background

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Mainly secreted by macrophages, it possesses the capability to induce cell death in specific tumor cell lines and functions as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion. Implicated in the induction of cachexia, TNF-alpha exhibits diverse roles; under certain conditions, it can stimulate cell proliferation and induce cell differentiation. Additionally, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake, contributing to GKAP42 protein degradation and TNF-induced insulin resistance. TNF-alpha plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and it promotes osteoclastogenesis, mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, highlighting its multifaceted impact across various physiological processes.

Species

Others

Source

Sf9 insect cells

Tag

N-10*His

Accession

O35734 (G57-L233)

Gene ID

124109351  [NCBI]

Molecular Construction
N-term
10*His
TGF-α (G57-L233)
Accession # O35734
C-term
Protein Length

Extracellular Domain

Synonyms
rHuTNF-α, His; Cachectin; TNFSF2
AA Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Predicted Molecular Mass
22.2 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Marmota monax (sf9, His)
Cat. No.:
HY-P700504
Quantity:
MCE Japan Authorized Agent: