1. Recombinant Proteins
  2. Others
  3. TMEM119 Protein, Human (P. pastoris, His)

The TMEM119 protein is critical in bone formation and helps myoblasts differentiate into osteoblasts. It induces commitment and differentiation by enhancing BMP2 production and interacting with the BMP-RUNX2 pathway. TMEM119 Protein, Human (P. pastoris, His) is the recombinant human-derived TMEM119 protein, expressed by P. pastoris, with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TMEM119 protein is critical in bone formation and helps myoblasts differentiate into osteoblasts. It induces commitment and differentiation by enhancing BMP2 production and interacting with the BMP-RUNX2 pathway. TMEM119 Protein, Human (P. pastoris, His) is the recombinant human-derived TMEM119 protein, expressed by P. pastoris, with N-6*His labeled tag.

Background

The TMEM119 protein plays a crucial role in bone formation and the normal mineralization of bones, actively participating in the differentiation of myoblasts into osteoblasts. It is suggested to induce the commitment and differentiation of myoblasts into osteoblasts through the enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. TMEM119 also contributes to osteoblast differentiation by up-regulating the expression of ATF4, a central transcription factor in this process. Beyond its role in bone development, TMEM119 is deemed essential for normal spermatogenesis and late testicular differentiation. Molecularly, TMEM119 interacts with key regulators of osteogenesis, including SMAD1, SMAD5, and RUNX2, underlining its intricate involvement in bone formation and spermatogenesis processes, highlighting its significance in multiple facets of physiological development.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

Q4V9L6 (R26-M96)

Gene ID

338773

Molecular Construction
N-term
6*His
TMEM119 (R26-M96)
Accession # Q4V9L6
C-term
Protein Length

Extracellular Domain

Synonyms
TMEM119; Transmembrane protein 119; Osteoblast induction factor (OBIF)
AA Sequence

RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

Predicted Molecular Mass
9.4 kDa
Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TMEM119 Protein, Human (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM119 Protein, Human (P. pastoris, His)
Cat. No.:
HY-P704155
Quantity:
MCE Japan Authorized Agent: